PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00936.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 323aa    MW: 34883.5 Da    PI: 9.8493
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00936.1_g00012.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.71.2e-3870128361
                   zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                              e alkcprCds ntkfCyynny+l+qPryfCk+CrryWt+GGalrnvPvGgg+r+n k+
  Rsa1.0_00936.1_g00012.1  70 EGALKCPRCDSLNTKFCYYNNYNLTQPRYFCKGCRRYWTHGGALRNVPVGGGSRRNSKK 128
                              5689***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-2755118IPR003851Zinc finger, Dof-type
PfamPF027017.6E-3372127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1873127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MPTNSNHQQH QLHENGSLVS GHGLLSHQLP PYPPNPNPNH HHAAASSGLP ARLGASMAER  60
ARQAKAPPPE GALKCPRCDS LNTKFCYYNN YNLTQPRYFC KGCRRYWTHG GALRNVPVGG  120
GSRRNSKKGK NGNSKSSSSL SKQSSSTVNA PSSSSGQLRT NHQFPFSPTL HNLTQLGGIG  180
LNLAATNGNN QAHQIGPSLM NDLGFLHVGN ERTGNIHDNN NSVQNNLMAA AGSMNQFTLF  240
DPATTLYAFQ NEGNIGISFS STSMVDSRGY HTAPVKMEEQ PSLVNLSRPV SSLTPPGNQT  300
SQYFWNNSDL SGPSSNDHHH QLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5842851e-160FJ584285.1 Brassica rapa subsp. pekinensis OBF binding protein 2 Dof1.1-2 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013708450.10.0PREDICTED: dof zinc finger protein DOF1.1-like isoform X3
SwissprotQ8L9V61e-159DOF11_ARATH; Dof zinc finger protein DOF1.1
TrEMBLA0A078E3L11e-180A0A078E3L1_BRANA; BnaC05g05320D protein
STRINGBra030696.1-P1e-161(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.21e-130Dof family protein